PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002521.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 67aa    MW: 7479.44 Da    PI: 5.4671
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002521.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.52e-171058150
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                             lppGfrF P+deel+++yL +k+++++++   ++ evd++++ePw+Lp +
  Itr_sc002521.1_g00001.1 10 LPPGFRFYPSDEELICHYLYNKIANQNVSK-GTLVEVDLHTCEPWQLPGT 58
                             79*************************988.88**************942 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-19861IPR003441NAC domain
PROSITE profilePS5100519.0381067IPR003441NAC domain
PfamPF023651.0E-81153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELICHYLYN KIANQNVSKG TLVEVDLHTC EPWQLPGTYL  60
ASSSSHP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490707.14e-32PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotO040172e-16NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLB9SV351e-33B9SV35_RICCO; Putative uncharacterized protein
STRINGPOPTR_0005s24760.13e-33(Populus trichocarpa)
STRINGSolyc09g025310.2.13e-31(Solanum lycopersicum)
STRINGPGSC0003DMT4000266444e-31(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1976633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.28e-22NAC domain containing protein 74